Transcript: OMERI06G01810.7

Location

Chromosome 6: 1,541,227-1,558,783 forward strand.

About this transcript

This transcript has 14 exons, is annotated with 20 domains and features and maps to 19 oligo probes.

Gene

This transcript is a product of gene OMERI06G01810 Show transcript tableHide transcript table

Name	Transcript ID	bp	Protein	Biotype	UniProt	Flags
-	OMERI06G01810.6	3516	408aa	Gene/transcipt that contains an open reading frame (ORF).Protein coding	A0A0E0DW60	A single transcript chosen for a gene which is the most conserved, most highly expressed, has the longest coding sequence and is represented in other key resources, such as NCBI and UniProt. This is defined in detail on http://www.ensembl.org/info/genome/genebuild/canonical.htmlEnsembl Canonical,
-	OMERI06G01810.4	2580	408aa	Gene/transcipt that contains an open reading frame (ORF).Protein coding	A0A0E0DW60	-
-	OMERI06G01810.1	2548	408aa	Gene/transcipt that contains an open reading frame (ORF).Protein coding	A0A0E0DW60	-
-	OMERI06G01810.2	2500	392aa	Gene/transcipt that contains an open reading frame (ORF).Protein coding	A0A0E0DW56	-
-	OMERI06G01810.9	2400	348aa	Gene/transcipt that contains an open reading frame (ORF).Protein coding	A0A0E0DW63	-
-	OMERI06G01810.7	2353	343aa	Gene/transcipt that contains an open reading frame (ORF).Protein coding	A0A0E0DW61	-
-	OMERI06G01810.3	1975	408aa	Gene/transcipt that contains an open reading frame (ORF).Protein coding	A0A0E0DW57	-
-	OMERI06G01810.5	1927	392aa	Gene/transcipt that contains an open reading frame (ORF).Protein coding	A0A0E0DW59	-
-	OMERI06G01810.8	1783	344aa	Gene/transcipt that contains an open reading frame (ORF).Protein coding	A0A0E0DW62	-

Protein sequence

Download sequence BLAST this sequence

Exons

An exon
Another exon
Residue overlaps splice site

Markup

loadingloaded

▼▲

MALAEAENPPRRRRPAPDPVAVLRGHRAAVNDVCFHPFLPLIFSGAADGELRVWDTASHR
TVSSVWAHGGSAGVYSVAASTRLGNKIISQGRDGSCKCWEVEEAGLSRRALYTIRTSTYH
FCKMSLVKSTCSTCCTQSGLSSATGDIESQSTVTEERELGTCCKGPNIMAIAGQESSQVE
LWDIDNAIKVMCLPEICSANLADHLTKQRALSIAIDGLCNGGISGGADDKIVMFGLDHQK
GAFILRKEIKLERPGIAGTAIRPDNKIAATAGWDHRIRVYSYSKGNALAVLKYHSASCNA
VTFSSDSKLLASCSADTTVALWELYPPKTDSQVGLKTRDEISQ

Transcript: OMERI06G01810.7

Protein sequence

About Us

Get help

Our sister sites

Follow us

Favourite species

All species

Recent locations

Transcript: OMERI06G01810.7

Protein sequence

About Us

Get help

Our sister sites

Follow us