We need your help! Has Ensembl saved you time or effort? Please take 15 minutes to fill in a survey and help EMBL-EBI make the case for why open data resources are critical to life science research.
https://www.surveymonkey.com/r/QGFMBH8?channel=[webpage]

Ensembl Genomes HomeEnsembl Plants HomeEnsembl Plants Home ▼
More ▼
    Search »
    Leersia perrieri (Lperr_V1.4) ▼

    Favourite species

    All species

    Recent locations

    Transcript-based displays

    Configure this page

    Custom tracks

    Export data

    Bookmark this page

    Transcript: LPERR10G08370.1

    Location

    Chromosome 10: 10,054,112-10,057,110 reverse strand.

    About this transcript

    This transcript has 6 exons and is annotated with 22 domains and features.

    Gene

    This transcript is a product of gene LPERR10G08370 Show transcript tableHide transcript table

    Show/hide columns (1 hidden)
    • Name
    • Transcript ID
    • bp
    • Protein
    • Translation ID
    • Biotype
    • UniProt
    • Flags
    Download what you seeDownload whole table
    NameTranscript IDbpProteinBiotypeUniProtFlags
    -LPERR10G08370.1552183aa
     
    Protein coding
    		A0A0D9XK51 Ensembl Canonical

    Protein sequence

    Download sequenceBLAST this sequence
    Exons
    • An exon
    • Another exon
    • Residue overlaps splice site
    Markup
    • loading
    ▼▲
    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWKVRVELPDAYP
YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
NGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGVTPEDKSSDEELSEDEDDSGDDAILGN
PDP

    This website requires cookies, and the limited processing of your personal data in order to function. By using the site you are agreeing to this as outlined in our Privacy Policy and Terms of Use

    I Agree